MUC1 anticorps (Middle Region)

N° du produit ABIN635176

Cet anticorps Lapin Polyclonal détecte spécifiquement MUC1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour MUC1 anticorps (Middle Region) (ABIN635176)

Antigène: MUC1 (Mucin 1 (MUC1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MUC1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MUC1 anticorps

Épitope: Middle Region

Specificité: MUC1 antibody was raised against the middle region of MUC1

Purification: Affinity purified

Immunogène: MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MUC1 Blocking Peptide, (ABIN936918), is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MUC1

Antigène: MUC1 (Mucin 1 (MUC1))

Autre désignation: MUC1

Sujet: MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.

Poids moléculaire: 14 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling